PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29269.m000250
Common NameRCOM_0413690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 349aa    MW: 37255 Da    PI: 9.2945
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29269.m000250genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1391.3e-4347122176
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                    +CqvegC++dls+ak y++rhkvC +hsk+p+v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  29269.m000250  47 RCQVEGCKVDLSDAKAYYSRHKVCGMHSKSPKVIVAGLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKP 122
                    6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-3540109IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.50545122IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-4146126IPR004333Transcription factor, SBP-box
PfamPF031108.4E-3348121IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MEMGSGSLSE SGSGAPVKSS SPGSSSSSSG SGAPARKVHG GQQQPPRCQV EGCKVDLSDA  60
KAYYSRHKVC GMHSKSPKVI VAGLEQRFCQ QCSRFHQLPE FDQGKRSCRR RLAGHNERRR  120
KPPPGSLLSS RYSRLSSTVF DNSSRAGGFL VDFSAYPRLS ARDAWPSARP SERVPGNHTT  180
GAGRSIPNPW QTSSQNPPSN LYLQGSASGT GFSSSENPSG ECFTGVSIAD SSCALSLLSN  240
QPWGSRNQAS GLGVKNLVDP QGAPLAQSTN PHGAAVNQYP NPSWGFKGSE AGSSSHEMCP  300
DLGLGQISQP PNGHFAGELE LSQQNRRQYM ELDHSRAYDS STQHMNWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-32481211184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015582800.10.0PREDICTED: squamosa promoter-binding-like protein 9
SwissprotQ700W22e-76SPL9_ARATH; Squamosa promoter-binding-like protein 9
TrEMBLB9T2740.0B9T274_RICCO; LIGULELESS1 protein, putative
STRINGVIT_08s0007g06270.t011e-162(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.15e-70squamosa promoter binding protein-like 9